HNRNPL polyclonal antibody
  • HNRNPL polyclonal antibody

HNRNPL polyclonal antibody

Ref: AB-PAB29878
HNRNPL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human HNRNPL.
Información adicional
Size 100 uL
Gene Name HNRNPL
Gene Alias FLJ35509|HNRPL|P/OKcl.14|hnRNP-L
Gene Description heterogeneous nuclear ribonucleoprotein L
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF,IP
Immunogen Prot. Seq AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
Form Liquid
Recomended Dilution Immunofluorescence (1:200)
Immunohistochemistry (1:250)
Immunoprecipitation
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 82-131 of human HNRNPL.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 3191
Iso type IgG

Enviar uma mensagem


HNRNPL polyclonal antibody

HNRNPL polyclonal antibody