EDF1 polyclonal antibody
  • EDF1 polyclonal antibody

EDF1 polyclonal antibody

Ref: AB-PAB29872
EDF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human EDF1.
Información adicional
Size 100 uL
Gene Name EDF1
Gene Alias EDF-1|MBF1|MGC9058
Gene Description endothelial differentiation-related factor 1
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
Form Liquid
Recomended Dilution Immunofluorescence (1:200)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 1-50 of human EDF1.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 8721
Iso type IgG

Enviar uma mensagem


EDF1 polyclonal antibody

EDF1 polyclonal antibody