HTR3E polyclonal antibody
  • HTR3E polyclonal antibody

HTR3E polyclonal antibody

Ref: AB-PAB29871
HTR3E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human HTR3E.
Información adicional
Size 100 uL
Gene Name HTR3E
Gene Alias 5-HT3c1|MGC120035|MGC120036|MGC120037
Gene Description 5-hydroxytryptamine (serotonin) receptor 3, family member E
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IF
Immunogen Prot. Seq RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
Form Liquid
Recomended Dilution Immunofluorescence (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 345-394 of human HTR3E.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 285242
Iso type IgG

Enviar uma mensagem


HTR3E polyclonal antibody

HTR3E polyclonal antibody