HTR3B polyclonal antibody
  • HTR3B polyclonal antibody

HTR3B polyclonal antibody

Ref: AB-PAB29870
HTR3B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human HTR3B.
Información adicional
Size 100 uL
Gene Name HTR3B
Gene Alias 5-HT3B
Gene Description 5-hydroxytryptamine (serotonin) receptor 3B
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
Form Liquid
Recomended Dilution Immunofluorescence (1:250)
Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 8-57 of human HTR3B.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 9177
Iso type IgG

Enviar uma mensagem


HTR3B polyclonal antibody

HTR3B polyclonal antibody