TEAD4 polyclonal antibody
  • TEAD4 polyclonal antibody

TEAD4 polyclonal antibody

Ref: AB-PAB29867
TEAD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human TEAD4.
Información adicional
Size 100 uL
Gene Name TEAD4
Gene Alias EFTR-2|MGC9014|RTEF1|TCF13L1|TEF-3|TEFR-1|hRTEF-1B
Gene Description TEA domain family member 4
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEK
Form Liquid
Recomended Dilution Immunofluorescence (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 295-344 of human TEAD4.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 7004
Iso type IgG

Enviar uma mensagem


TEAD4 polyclonal antibody

TEAD4 polyclonal antibody