MS4A1 polyclonal antibody
  • MS4A1 polyclonal antibody

MS4A1 polyclonal antibody

Ref: AB-PAB29580
MS4A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MS4A1.
Información adicional
Size 100 uL
Gene Name MS4A1
Gene Alias B1|Bp35|CD20|LEU-16|MGC3969|MS4A2|S7
Gene Description membrane-spanning 4-domains, subfamily A, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 149-184 of human MS4A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 931
Iso type IgG

Enviar uma mensagem


MS4A1 polyclonal antibody

MS4A1 polyclonal antibody