CD300A polyclonal antibody
  • CD300A polyclonal antibody

CD300A polyclonal antibody

Ref: AB-PAB29578
CD300A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD300A.
Información adicional
Size 100 uL
Gene Name CD300A
Gene Alias CMRF-35-H9|CMRF-35H|CMRF35H|CMRF35H9|IGSF12|IRC1|IRC2|IRp60
Gene Description CD300a molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 98-149 of human CD300A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11314
Iso type IgG

Enviar uma mensagem


CD300A polyclonal antibody

CD300A polyclonal antibody