LAIR1 polyclonal antibody
  • LAIR1 polyclonal antibody

LAIR1 polyclonal antibody

Ref: AB-PAB29577
LAIR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LAIR1.
Información adicional
Size 100 uL
Gene Name LAIR1
Gene Alias CD305|LAIR-1
Gene Description leukocyte-associated immunoglobulin-like receptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 187-287 of human LAIR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3903
Iso type IgG

Enviar uma mensagem


LAIR1 polyclonal antibody

LAIR1 polyclonal antibody