PDCD1 polyclonal antibody
  • PDCD1 polyclonal antibody

PDCD1 polyclonal antibody

Ref: AB-PAB29574
PDCD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PDCD1.
Información adicional
Size 100 uL
Gene Name PDCD1
Gene Alias CD279|PD1|SLEB2|hPD-1|hPD-l
Gene Description programmed cell death 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PDCD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5133
Iso type IgG

Enviar uma mensagem


PDCD1 polyclonal antibody

PDCD1 polyclonal antibody