CD38 polyclonal antibody
  • CD38 polyclonal antibody

CD38 polyclonal antibody

Ref: AB-PAB29570
CD38 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CD38.
Información adicional
Size 100 uL
Gene Name CD38
Gene Alias T10
Gene Description CD38 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD38.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 952
Iso type IgG

Enviar uma mensagem


CD38 polyclonal antibody

CD38 polyclonal antibody