CD34 polyclonal antibody
  • CD34 polyclonal antibody

CD34 polyclonal antibody

Ref: AB-PAB29566
CD34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CD34.
Información adicional
Size 100 uL
Gene Name CD34
Gene Alias -
Gene Description CD34 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD34.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 947
Iso type IgG

Enviar uma mensagem


CD34 polyclonal antibody

CD34 polyclonal antibody