FGFR2 polyclonal antibody
  • FGFR2 polyclonal antibody

FGFR2 polyclonal antibody

Ref: AB-PAB29563
FGFR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FGFR2.
Información adicional
Size 100 uL
Gene Name FGFR2
Gene Alias BEK|BFR-1|CD332|CEK3|CFD1|ECT1|FLJ98662|JWS|K-SAM|KGFR|TK14|TK25
Gene Description fibroblast growth factor receptor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 38-122 of human FGFR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2263
Iso type IgG

Enviar uma mensagem


FGFR2 polyclonal antibody

FGFR2 polyclonal antibody