ABCB1 polyclonal antibody
  • ABCB1 polyclonal antibody

ABCB1 polyclonal antibody

Ref: AB-PAB29562
ABCB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1.
Información adicional
Size 100 ug
Gene Name ABCB1
Gene Alias ABC20|CD243|CLCS|GP170|MDR1|MGC163296|P-GP|PGY1
Gene Description ATP-binding cassette, sub-family B (MDR/TAP), member 1
Storage Conditions Store at -20C.
After reconstitution with 0.2 mL of deionized water, store at 4C for 1 month. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IHC-Fr
Immunogen Prot. Seq IYFKLVTMQTAGNEVELENAADESKSEIDA
Form Lyophilized
Recomended Dilution Immunohistochemistry (Frozen sections) (0.5-1 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 621-650 at internal region of human ABCB1.
Storage Buffer Lyophilized from 0.9 mg NaCl, 0.2 mg Na2HPO4 (5 mg BSA, 0.05 mg sodium azide)
Gene ID 5243
Iso type IgG

Enviar uma mensagem


ABCB1 polyclonal antibody

ABCB1 polyclonal antibody