VSX2 polyclonal antibody
  • VSX2 polyclonal antibody

VSX2 polyclonal antibody

Ref: AB-PAB29547
VSX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human VSX2.
Información adicional
Size 100 uL
Gene Name VSX2
Gene Alias CHX10|HOX10|MCOP2|MCOPCB3|RET1
Gene Description visual system homeobox 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human VSX2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 338917
Iso type IgG

Enviar uma mensagem


VSX2 polyclonal antibody

VSX2 polyclonal antibody