PLAT polyclonal antibody
  • PLAT polyclonal antibody

PLAT polyclonal antibody

Ref: AB-PAB29546
PLAT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PLAT.
Información adicional
Size 100 uL
Gene Name PLAT
Gene Alias DKFZp686I03148|T-PA|TPA
Gene Description plasminogen activator, tissue
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PLAT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5327
Iso type IgG

Enviar uma mensagem


PLAT polyclonal antibody

PLAT polyclonal antibody