IFIT2 polyclonal antibody
  • IFIT2 polyclonal antibody

IFIT2 polyclonal antibody

Ref: AB-PAB29545
IFIT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human IFIT2.
Información adicional
Size 100 uL
Gene Name IFIT2
Gene Alias G10P2|GARG-39|IFI-54|IFI54|ISG-54K|ISG54|cig42
Gene Description interferon-induced protein with tetratricopeptide repeats 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IFIT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3433
Iso type IgG

Enviar uma mensagem


IFIT2 polyclonal antibody

IFIT2 polyclonal antibody