SH3KBP1 polyclonal antibody
  • SH3KBP1 polyclonal antibody

SH3KBP1 polyclonal antibody

Ref: AB-PAB29542
SH3KBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SH3KBP1.
Información adicional
Size 100 uL
Gene Name SH3KBP1
Gene Alias CIN85|GIG10|MIG18
Gene Description SH3-domain kinase binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq WEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SH3KBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 30011
Iso type IgG

Enviar uma mensagem


SH3KBP1 polyclonal antibody

SH3KBP1 polyclonal antibody