DUSP9 polyclonal antibody
  • DUSP9 polyclonal antibody

DUSP9 polyclonal antibody

Ref: AB-PAB29541
DUSP9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human DUSP9.
Información adicional
Size 100 uL
Gene Name DUSP9
Gene Alias MKP-4|MKP4
Gene Description dual specificity phosphatase 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DUSP9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1852
Iso type IgG

Enviar uma mensagem


DUSP9 polyclonal antibody

DUSP9 polyclonal antibody