ZNF157 polyclonal antibody
  • ZNF157 polyclonal antibody

ZNF157 polyclonal antibody

Ref: AB-PAB29539
ZNF157 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ZNF157.
Información adicional
Size 100 uL
Gene Name ZNF157
Gene Alias HZF22
Gene Description zinc finger protein 157
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEHLRIHTGER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZNF157.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7712
Iso type IgG

Enviar uma mensagem


ZNF157 polyclonal antibody

ZNF157 polyclonal antibody