CUX1 polyclonal antibody
  • CUX1 polyclonal antibody

CUX1 polyclonal antibody

Ref: AB-PAB29534
CUX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CUX1.
Información adicional
Size 100 uL
Gene Name CUX1
Gene Alias CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75
Gene Description cut-like homeobox 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CUX1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1523
Iso type IgG

Enviar uma mensagem


CUX1 polyclonal antibody

CUX1 polyclonal antibody