CCT2 polyclonal antibody
  • CCT2 polyclonal antibody

CCT2 polyclonal antibody

Ref: AB-PAB29532
CCT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CCT2.
Información adicional
Size 100 uL
Gene Name CCT2
Gene Alias 99D8.1|CCT-beta|CCTB|MGC142074|MGC142076|PRO1633|TCP-1-beta
Gene Description chaperonin containing TCP1, subunit 2 (beta)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CCT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10576
Iso type IgG

Enviar uma mensagem


CCT2 polyclonal antibody

CCT2 polyclonal antibody