FRMPD3 polyclonal antibody
  • FRMPD3 polyclonal antibody

FRMPD3 polyclonal antibody

Ref: AB-PAB29531
FRMPD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human FRMPD3.
Información adicional
Size 100 uL
Gene Name FRMPD3
Gene Alias KIAA1817
Gene Description FERM and PDZ domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMLTLQDRLSLRFIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQVESGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FRMPD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84443
Iso type IgG

Enviar uma mensagem


FRMPD3 polyclonal antibody

FRMPD3 polyclonal antibody