ECH1 polyclonal antibody
  • ECH1 polyclonal antibody

ECH1 polyclonal antibody

Ref: AB-PAB29527
ECH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ECH1.
Información adicional
Size 100 uL
Gene Name ECH1
Gene Alias HPXEL
Gene Description enoyl Coenzyme A hydratase 1, peroxisomal
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ECH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1891
Iso type IgG

Enviar uma mensagem


ECH1 polyclonal antibody

ECH1 polyclonal antibody