NBN polyclonal antibody
  • NBN polyclonal antibody

NBN polyclonal antibody

Ref: AB-PAB29518
NBN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NBN.
Información adicional
Size 100 uL
Gene Name NBN
Gene Alias AT-V1|AT-V2|ATV|FLJ10155|MGC87362|NBS|NBS1|P95
Gene Description nibrin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NBN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4683
Iso type IgG

Enviar uma mensagem


NBN polyclonal antibody

NBN polyclonal antibody