ZC3H12B polyclonal antibody
  • ZC3H12B polyclonal antibody

ZC3H12B polyclonal antibody

Ref: AB-PAB29510
ZC3H12B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ZC3H12B.
Información adicional
Size 100 uL
Gene Name ZC3H12B
Gene Alias CXorf32|MCPIP2
Gene Description zinc finger CCCH-type containing 12B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq GRALVMTRMDSISDSRLYESNPVRQRRPPLCREQHASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVRSVPEKMEQLWRNPWVGMCNDSREHMIPEHQYQTYKNLCN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZC3H12B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340554
Iso type IgG

Enviar uma mensagem


ZC3H12B polyclonal antibody

ZC3H12B polyclonal antibody