FOXP2 polyclonal antibody
  • FOXP2 polyclonal antibody

FOXP2 polyclonal antibody

Ref: AB-PAB29509
FOXP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human FOXP2.
Información adicional
Size 100 uL
Gene Name FOXP2
Gene Alias CAGH44|DKFZp686H1726|SPCH1|TNRC10
Gene Description forkhead box P2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FOXP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93986
Iso type IgG

Enviar uma mensagem


FOXP2 polyclonal antibody

FOXP2 polyclonal antibody