COX4NB polyclonal antibody
  • COX4NB polyclonal antibody

COX4NB polyclonal antibody

Ref: AB-PAB29503
COX4NB polyclonal antibody

Información del producto

COX4NB polyclonal antibody raised against recombinant human COX4NB.
Información adicional
Size 100 uL
Gene Name COX4NB
Gene Alias C16orf2|C16orf4|FAM158B|NOC4
Gene Description COX4 neighbor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COX4NB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10328
Iso type IgG

Enviar uma mensagem


COX4NB polyclonal antibody

COX4NB polyclonal antibody