APOB polyclonal antibody
  • APOB polyclonal antibody

APOB polyclonal antibody

Ref: AB-PAB29501
APOB polyclonal antibody

Información del producto

APOB polyclonal antibody raised against recombinant human APOB.
Información adicional
Size 100 uL
Gene Name APOB
Gene Alias FLDB
Gene Description apolipoprotein B (including Ag(x) antigen)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APOB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 338
Iso type IgG

Enviar uma mensagem


APOB polyclonal antibody

APOB polyclonal antibody