CDC6 polyclonal antibody
  • CDC6 polyclonal antibody

CDC6 polyclonal antibody

Ref: AB-PAB29498
CDC6 polyclonal antibody

Información del producto

CDC6 polyclonal antibody raised against recombinant human CDC6.
Información adicional
Size 100 uL
Gene Name CDC6
Gene Alias CDC18L|HsCDC18|HsCDC6
Gene Description cell division cycle 6 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDC6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 990
Iso type IgG

Enviar uma mensagem


CDC6 polyclonal antibody

CDC6 polyclonal antibody