CD83 polyclonal antibody
  • CD83 polyclonal antibody

CD83 polyclonal antibody

Ref: AB-PAB29493
CD83 polyclonal antibody

Información del producto

CD83 polyclonal antibody raised against recombinant human CD83.
Información adicional
Size 100 uL
Gene Name CD83
Gene Alias BL11|HB15
Gene Description CD83 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD83.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9308
Iso type IgG

Enviar uma mensagem


CD83 polyclonal antibody

CD83 polyclonal antibody