SLC3A2 polyclonal antibody
  • SLC3A2 polyclonal antibody

SLC3A2 polyclonal antibody

Ref: AB-PAB29491
SLC3A2 polyclonal antibody

Información del producto

SLC3A2 polyclonal antibody raised against recombinant human SLC3A2.
Información adicional
Size 100 uL
Gene Name SLC3A2
Gene Alias 4F2|4F2HC|4T2HC|CD98|CD98HC|MDU1|NACAE
Gene Description solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC3A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6520
Iso type IgG

Enviar uma mensagem


SLC3A2 polyclonal antibody

SLC3A2 polyclonal antibody