TNFRSF14 polyclonal antibody View larger

TNFRSF14 polyclonal antibody raised against recombinant human TNFRSF14.

AB-PAB29485

New product

TNFRSF14 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name TNFRSF14
Gene Alias ATAR|HVEA|HVEM|LIGHTR|TR2
Gene Description tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (1:20-1:50)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TNFRSF14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8764
Iso type IgG

More info

TNFRSF14 polyclonal antibody raised against recombinant human TNFRSF14.

Enviar uma mensagem

TNFRSF14 polyclonal antibody raised against recombinant human TNFRSF14.

TNFRSF14 polyclonal antibody raised against recombinant human TNFRSF14.