POLD3 polyclonal antibody
  • POLD3 polyclonal antibody

POLD3 polyclonal antibody

Ref: AB-PAB29475
POLD3 polyclonal antibody

Información del producto

POLD3 polyclonal antibody raised against recombinant human POLD3.
Información adicional
Size 100 uL
Gene Name POLD3
Gene Alias KIAA0039|MGC119642|MGC119643|P66|P68
Gene Description polymerase (DNA-directed), delta 3, accessory subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POLD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10714
Iso type IgG

Enviar uma mensagem


POLD3 polyclonal antibody

POLD3 polyclonal antibody