TIPIN polyclonal antibody
  • TIPIN polyclonal antibody

TIPIN polyclonal antibody

Ref: AB-PAB29474
TIPIN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human TIPIN.
Información adicional
Size 100 uL
Gene Name TIPIN
Gene Alias FLJ20516
Gene Description TIMELESS interacting protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq HEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TIPIN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54962
Iso type IgG

Enviar uma mensagem


TIPIN polyclonal antibody

TIPIN polyclonal antibody