View larger
Rabbit polyclonal antibody raised against recombinant human CGNL1.
AB-PAB29471
New product
CGNL1 polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | CGNL1 |
| Gene Alias | FLJ14957|JACOP|KIAA1749|MGC138254 |
| Gene Description | cingulin-like 1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P,IF |
| Immunogen Prot. Seq | NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:1000-1:2500)<br>Immunofluorescence (1-4 ug/mL)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human CGNL1. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 84952 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant human CGNL1.