IFIT1 polyclonal antibody
  • IFIT1 polyclonal antibody

IFIT1 polyclonal antibody

Ref: AB-PAB29464
IFIT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human IFIT1.
Información adicional
Size 100 uL
Gene Name IFIT1
Gene Alias G10P1|GARG-16|IFI-56|IFI56|IFNAI1|ISG56|RNM561
Gene Description interferon-induced protein with tetratricopeptide repeats 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IFIT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3434
Iso type IgG

Enviar uma mensagem


IFIT1 polyclonal antibody

IFIT1 polyclonal antibody