RBL1 polyclonal antibody
  • RBL1 polyclonal antibody

RBL1 polyclonal antibody

Ref: AB-PAB29459
RBL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RBL1.
Información adicional
Size 100 uL
Gene Name RBL1
Gene Alias CP107|MGC40006|PRB1|p107
Gene Description retinoblastoma-like 1 (p107)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RBL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5933
Iso type IgG

Enviar uma mensagem


RBL1 polyclonal antibody

RBL1 polyclonal antibody