LIMA1 polyclonal antibody
  • LIMA1 polyclonal antibody

LIMA1 polyclonal antibody

Ref: AB-PAB29449
LIMA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human LIMA1.
Información adicional
Size 100 uL
Gene Name LIMA1
Gene Alias EPLIN|FLJ38853|MGC131726|SREBP3
Gene Description LIM domain and actin binding 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq RPHKDLWASKNENEEILERPAQLANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human LIMA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51474
Iso type IgG

Enviar uma mensagem


LIMA1 polyclonal antibody

LIMA1 polyclonal antibody