NFIC polyclonal antibody
  • NFIC polyclonal antibody

NFIC polyclonal antibody

Ref: AB-PAB29447
NFIC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NFIC.
Información adicional
Size 100 uL
Gene Name NFIC
Gene Alias CTF|CTF5|MGC20153|NF-I|NFI
Gene Description nuclear factor I/C (CCAAT-binding transcription factor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NFIC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4782
Iso type IgG

Enviar uma mensagem


NFIC polyclonal antibody

NFIC polyclonal antibody