EID1 polyclonal antibody
  • EID1 polyclonal antibody

EID1 polyclonal antibody

Ref: AB-PAB29435
EID1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human EID1.
Información adicional
Size 100 uL
Gene Name EID1
Gene Alias C15orf3|CRI1|EID-1|IRO45620|MGC138883|MGC138884|PNAS-22|PTD014|RBP21
Gene Description EP300 interacting inhibitor of differentiation 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EID1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23741
Iso type IgG

Enviar uma mensagem


EID1 polyclonal antibody

EID1 polyclonal antibody