PEG10 polyclonal antibody
  • PEG10 polyclonal antibody

PEG10 polyclonal antibody

Ref: AB-PAB29434
PEG10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PEG10.
Información adicional
Size 100 uL
Gene Name PEG10
Gene Alias Edr|HB-1|KIAA1051|MEF3L|Mar2|Mart2|RGAG3
Gene Description paternally expressed 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PEG10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23089
Iso type IgG

Enviar uma mensagem


PEG10 polyclonal antibody

PEG10 polyclonal antibody