CLTA polyclonal antibody
  • CLTA polyclonal antibody

CLTA polyclonal antibody

Ref: AB-PAB29433
CLTA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CLTA.
Información adicional
Size 100 uL
Gene Name CLTA
Gene Alias LCA
Gene Description clathrin, light chain (Lca)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CLTA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1211
Iso type IgG

Enviar uma mensagem


CLTA polyclonal antibody

CLTA polyclonal antibody