RPL28 polyclonal antibody
  • RPL28 polyclonal antibody

RPL28 polyclonal antibody

Ref: AB-PAB29428
RPL28 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RPL28.
Información adicional
Size 100 uL
Gene Name RPL28
Gene Alias FLJ43307
Gene Description ribosomal protein L28
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RPL28.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6158
Iso type IgG

Enviar uma mensagem


RPL28 polyclonal antibody

RPL28 polyclonal antibody