MDGA1 polyclonal antibody
  • MDGA1 polyclonal antibody

MDGA1 polyclonal antibody

Ref: AB-PAB29426
MDGA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MDGA1.
Información adicional
Size 100 uL
Gene Name MDGA1
Gene Alias DKFZp686K0262|DKFZp686L0262|FLJ45018|GPIM|MAMDC3
Gene Description MAM domain containing glycosylphosphatidylinositol anchor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MDGA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 266727
Iso type IgG

Enviar uma mensagem


MDGA1 polyclonal antibody

MDGA1 polyclonal antibody