RPL8 polyclonal antibody
  • RPL8 polyclonal antibody

RPL8 polyclonal antibody

Ref: AB-PAB29424
RPL8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RPL8.
Información adicional
Size 100 uL
Gene Name RPL8
Gene Alias -
Gene Description ribosomal protein L8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq VISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RPL8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6132
Iso type IgG

Enviar uma mensagem


RPL8 polyclonal antibody

RPL8 polyclonal antibody