SYNE2 polyclonal antibody
  • SYNE2 polyclonal antibody

SYNE2 polyclonal antibody

Ref: AB-PAB29410
SYNE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SYNE2.
Información adicional
Size 100 uL
Gene Name SYNE2
Gene Alias DKFZp434H2235|DKFZp686E01115|DKFZp686H1931|FLJ11014|FLJ43727|FLJ45710|FLJ46790|KIAA1011|NUA|NUANCE|Nesprin-2|SYNE-2
Gene Description spectrin repeat containing, nuclear envelope 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQEELESTVARIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SYNE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23224
Iso type IgG

Enviar uma mensagem


SYNE2 polyclonal antibody

SYNE2 polyclonal antibody