MSL2 polyclonal antibody
  • MSL2 polyclonal antibody

MSL2 polyclonal antibody

Ref: AB-PAB29408
MSL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MSL2.
Información adicional
Size 100 uL
Gene Name MSL2
Gene Alias FLJ10546|KIAA1585|MSL-2|MSL2L1|RNF184
Gene Description male-specific lethal 2 homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MSL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55167
Iso type IgG

Enviar uma mensagem


MSL2 polyclonal antibody

MSL2 polyclonal antibody