UBE2L6 polyclonal antibody
  • UBE2L6 polyclonal antibody

UBE2L6 polyclonal antibody

Ref: AB-PAB29396
UBE2L6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human UBE2L6.
Información adicional
Size 100 uL
Gene Name UBE2L6
Gene Alias MGC40331|RIG-B|UBCH8
Gene Description ubiquitin-conjugating enzyme E2L 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq NLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBE2L6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9246
Iso type IgG

Enviar uma mensagem


UBE2L6 polyclonal antibody

UBE2L6 polyclonal antibody