SLC16A1 polyclonal antibody
  • SLC16A1 polyclonal antibody

SLC16A1 polyclonal antibody

Ref: AB-PAB29395
SLC16A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SLC16A1.
Información adicional
Size 100 uL
Gene Name SLC16A1
Gene Alias FLJ36745|HHF7|MCT|MCT1|MGC44475
Gene Description solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SLC16A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6566
Iso type IgG

Enviar uma mensagem


SLC16A1 polyclonal antibody

SLC16A1 polyclonal antibody