PHB polyclonal antibody
  • PHB polyclonal antibody

PHB polyclonal antibody

Ref: AB-PAB29392
PHB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PHB.
Información adicional
Size 100 uL
Gene Name PHB
Gene Alias PHB1
Gene Description prohibitin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq DVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PHB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5245
Iso type IgG

Enviar uma mensagem


PHB polyclonal antibody

PHB polyclonal antibody